PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 90720
Common NameRR2-1, SELMODRAFT_450181
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family ARR-B
Protein Properties Length: 261aa    MW: 29434.2 Da    PI: 7.1024
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
90720genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like81.78.4e-26198247151
  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
              kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQ
    90720 198 KPRVVWSVELHQQFVTAVNQL-GIDKAVPKRILELMNVQGLTRENVASHLQ 247
              79*******************.***************************** PP

2Response_reg761.4e-25201281109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+++ + +l+++l +  y +v+++  ++ al++l+e++  +D++l D+ mp+mdG++ll+     e++lp+i+++a+ge +++ + +  Ga 
         90720  20 VLVVDDDRTCLAILKKMLLRCAY-DVTTCGMARLALAMLRENKerFDVVLSDVCMPDMDGFKLLELVGL-EMDLPVIMMSANGETSLVMKGIIHGAC 114
                   89*********************.***************888778*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ ++el +
         90720 115 DYLLKPIRIKELKN 128
                   ***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.9E-1361248IPR017053Response regulator B-type, plant
SuperFamilySSF521722.28E-3417140IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.5E-4217154No hitNo description
SMARTSM004481.5E-2818130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011040.91919134IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.8E-2220128IPR001789Signal transduction response regulator, receiver domain
CDDcd001569.95E-2521134No hitNo description
SuperFamilySSF466892.15E-16195248IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-25197247IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-22198248IPR006447Myb domain, plants
PfamPF002492.3E-6200247IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MRIQASERDM GDQFPAGLRV LVVDDDRTCL AILKKMLLRC AYDVTTCGMA RLALAMLREN  60
KERFDVVLSD VCMPDMDGFK LLELVGLEMD LPVIMMSANG ETSLVMKGII HGACDYLLKP  120
IRIKELKNIW QHVFRRKRNI LKDADGADHD RQKRKPDEGD SMPAAGSAAA AGSKKRKEIK  180
EDDEEFELDM DDSNTLKKPR VVWSVELHQQ FVTAVNQLGI DKAVPKRILE LMNVQGLTRE  240
NVASHLQVSP HSLPRFYIFP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-18197247454ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002968894.11e-179type B response regulator
SwissprotQ6K8X62e-99ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLD8RDF01e-179D8RDF0_SELML; Type B response regulator
STRINGEFJ300101e-178(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.15e-91response regulator 2
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]